Tigerlake GCC 11 Compiler Optimization Benchmarks

Tests for a future article by Michael Larabel.

Compare your own system(s) to this result file with the Phoronix Test Suite by running the command: phoronix-test-suite benchmark 2011033-FI-TIGERLAKE42
Jump To Table - Results

View

Do Not Show Noisy Results
Do Not Show Results With Incomplete Data
Do Not Show Results With Little Change/Spread
List Notable Results
Show Result Confidence Charts
Allow Limiting Results To Certain Suite(s)

Statistics

Show Overall Harmonic Mean(s)
Show Overall Geometric Mean
Show Wins / Losses Counts (Pie Chart)
Normalize Results
Remove Outliers Before Calculating Averages

Graph Settings

Force Line Graphs Where Applicable
Convert To Scalar Where Applicable
Prefer Vertical Bar Graphs

Multi-Way Comparison

Condense Multi-Option Tests Into Single Result Graphs

Table

Show Detailed System Result Table

Run Management

Highlight
Result
Toggle/Hide
Result
Result
Identifier
View Logs
Performance Per
Dollar
Date
Run
  Test
  Duration
x86-64
November 03 2020
  4 Hours, 44 Minutes
sandybridge
November 02 2020
  4 Hours, 32 Minutes
haswell
November 02 2020
  4 Hours, 35 Minutes
skylake
November 01 2020
  4 Hours, 29 Minutes
icelake-client
November 01 2020
  4 Hours, 34 Minutes
tigerlake
October 31 2020
  4 Hours, 50 Minutes
Invert Behavior (Only Show Selected Data)
  4 Hours, 37 Minutes

Only show results where is faster than
Only show results matching title/arguments (delimit multiple options with a comma):
Do not show results matching title/arguments (delimit multiple options with a comma):


Tigerlake GCC 11 Compiler Optimization BenchmarksOpenBenchmarking.orgPhoronix Test SuiteIntel Core i7-1165G7 @ 4.70GHz (4 Cores / 8 Threads)Dell 0GG9PT (1.0.3 BIOS)Intel Tiger Lake-LP16GBKioxia KBG40ZNS256G NVMe 256GBIntel UHD 3GB (1300MHz)Realtek ALC289Intel Wi-Fi 6 AX201Ubuntu 20.105.10.0-051000rc1daily20201029-generic (x86_64) 20201028GNOME Shell 3.38.1X Server 1.20.9modesetting 1.20.94.6 Mesa 20.2.1OpenCL 3.01.2.145GCC 11.0.0 20201025ext41920x1200ProcessorMotherboardChipsetMemoryDiskGraphicsAudioNetworkOSKernelDesktopDisplay ServerDisplay DriverOpenGLOpenCLVulkanCompilerFile-SystemScreen ResolutionTigerlake GCC 11 Compiler Optimization Benchmarks PerformanceSystem Logs- x86-64: CXXFLAGS="-O3 -march=x86-64" CFLAGS="-O3 -march=x86-64"- sandybridge: CXXFLAGS="-O3 -march=sandybridge" CFLAGS="-O3 -march=sandybridge"- haswell: CXXFLAGS="-O3 -march=haswell" CFLAGS="-O3 -march=haswell"- skylake: CXXFLAGS="-O3 -march=skylake" CFLAGS="-O3 -march=skylake"- icelake-client: CXXFLAGS="-O3 -march=icelake-client" CFLAGS="-O3 -march=icelake-client"- tigerlake: CXXFLAGS="-O3 -march=tigerlake" CFLAGS="-O3 -march=tigerlake"- --disable-multilib --enable-checking=release- Scaling Governor: intel_pstate powersave - CPU Microcode: 0x60 - Thermald 2.3- itlb_multihit: Not affected + l1tf: Not affected + mds: Not affected + meltdown: Not affected + spec_store_bypass: Mitigation of SSB disabled via prctl and seccomp + spectre_v1: Mitigation of usercopy/swapgs barriers and __user pointer sanitization + spectre_v2: Mitigation of Enhanced IBRS IBPB: conditional RSB filling + srbds: Not affected + tsx_async_abort: Not affected - tigerlake: Python 3.8.6

x86-64sandybridgehaswellskylakeicelake-clienttigerlakeResult OverviewPhoronix Test Suite100%111%122%133%C-RayLibRawFFTWSciMarkHimeno BenchmarkVP9 libvpx EncodingGraphicsMagickdav1dAOBenchBullet Physics EngineKvazaarFLAC Audio EncodingRNNoiseSVT-VP9AOM AV1LAME MP3 Encoding7-Zip Compressionx264XZ CompressionTimed ImageMagick CompilationSQLite SpeedtestTimed FFmpeg CompilationTimed MAFFT AlignmentSVT-AV1Timed Apache CompilationTimed PHP CompilationZstd CompressionTimed MPlayer CompilationASTC EncoderOpenSSLCppPerformanceBenchmarksx265

Tigerlake GCC 11 Compiler Optimization Benchmarkscompress-7zip: Compress Speed Testaobench: 2048 x 2048 - Total Timeaom-av1: Speed 4 Realtimeaom-av1: Speed 5 Two-Passaom-av1: Speed 8 Realtimeastcenc: Thoroughastcenc: Exhaustivebullet: 3000 Fallbullet: 1000 Stackbullet: 1000 Convexbullet: 136 Ragdollsbullet: Prim Trimeshbullet: Convex Trimeshc-ray: Total Time - 4K, 16 Rays Per Pixelcpp-perf-bench: Atolcpp-perf-bench: Math Librarycpp-perf-bench: Stepanov Vectordav1d: Chimera 1080pdav1d: Summer Nature 4Kdav1d: Summer Nature 1080pdav1d: Chimera 1080p 10-bitfftw: Stock - 1D FFT Size 4096encode-flac: WAV To FLACgraphics-magick: Swirlgraphics-magick: Rotategraphics-magick: Sharpengraphics-magick: Enhancedgraphics-magick: Resizinggraphics-magick: Noise-Gaussiangraphics-magick: HWB Color Spacehimeno: Poisson Pressure Solverkvazaar: Bosphorus 4K - Slowkvazaar: Bosphorus 4K - Mediumkvazaar: Bosphorus 1080p - Slowkvazaar: Bosphorus 1080p - Mediumkvazaar: Bosphorus 4K - Very Fastkvazaar: Bosphorus 4K - Ultra Fastkvazaar: Bosphorus 1080p - Very Fastkvazaar: Bosphorus 1080p - Ultra Fastencode-mp3: WAV To MP3libraw: Post-Processing Benchmarkopenssl: RSA 4096-bit Performancernnoise: scimark2: Monte Carloscimark2: Dense LU Matrix Factorizationsqlite-speedtest: Timed Time - Size 1,000svt-av1: Enc Mode 4 - 1080psvt-av1: Enc Mode 8 - 1080psvt-vp9: PSNR/SSIM Optimized - Bosphorus 1080psvt-vp9: Visual Quality Optimized - Bosphorus 1080pbuild-apache: Time To Compilebuild-ffmpeg: Time To Compilebuild-imagemagick: Time To Compilemafft: Multiple Sequence Alignment - LSU RNAbuild-mplayer: Time To Compilebuild-php: Time To Compilevpxenc: Speed 0vpxenc: Speed 5x264: H.264 Video Encodingx265: Bosphorus 4Kx265: Bosphorus 1080pcompress-xz: Compressing ubuntu-16.04.3-server-i386.img, Compression Level 9compress-zstd: 3compress-zstd: 19x86-64sandybridgehaswellskylakeicelake-clienttigerlake2098927.4960.822.6841.7585.07729.613.0684883.4510863.4338081.9078450.6895420.843420219.70641.885235.05571.389298.1769.06292.2163.30113137.6481699954665324905474813.2050421.611.647.277.424.508.2118.7734.296.64930.48892.320.596916.046130.2352.3311.28611.37874.6354.5931.970163.78382.09310.176117.751122.0935.2518.2933.005.3024.8759.7693896.422.12135627.7880.812.6841.9084.78725.143.0441493.3970873.4270651.8980310.6755670.837192220.64641.751231.43572.324296.4469.22290.7576.72117087.5711789964768324915444851.7458751.61.627.197.354.478.3218.6934.596.49736.55899.420.103933.226807.0152.2311.29111.42375.0854.9231.954164.23082.45210.127118.439123.3785.3819.0133.005.2724.6760.2673923.421.72138425.7470.812.6741.8385.25728.052.8935713.1492753.2607981.7718520.6363870.785708159.43141.828229.91671.378297.9769.20293.9983.99132487.3141859686182362925405297.2449861.621.647.287.464.508.4218.8734.996.34638.48898.019.303922.907453.9253.0241.28911.42274.5354.5432.174163.82581.62710.241118.011122.9395.4820.1232.955.2424.6461.0234056.021.92129926.2850.832.7042.5385.04727.182.8926133.2062573.2906981.7609880.6410920.797150159.13041.651231.51672.242297.5169.65295.1783.83126847.2551839906275364915445352.2207021.651.687.437.624.618.5219.2635.226.36938.38892.419.571922.597448.4052.3811.29111.43274.4754.5231.727162.47682.27810.248117.001122.1565.5420.3633.115.2724.8160.5424035.321.82100326.3530.842.7042.1785.76731.132.885823.1535003.2661301.7445330.6420930.792352156.65941.594234.11572.010295.3068.93291.7783.60135047.1941849756283364915525326.0502251.671.707.507.664.638.5819.3235.676.33338.99892.919.389975.177524.9552.4111.28811.42874.8054.6932.372165.07982.14010.174118.343122.5055.5920.7033.155.2124.5059.7604021.021.82210324.7830.872.8144.1781.96707.192.8085053.0985353.2249931.7243820.6351970.78378153.12740.038225.64970.547310.7372.59307.4487.19138227.14818710506487382945855646.7317471.721.747.747.914.778.8920.0837.286.29640.21927.519.261980.858249.0550.5641.34611.88079.5057.7531.014157.49378.5619.799113.768118.2185.8822.2134.685.3825.2557.9954111.022.5OpenBenchmarking.org

7-Zip Compression

This is a test of 7-Zip using p7zip with its integrated benchmark feature or upstream 7-Zip for the Windows x64 build. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgMIPS, More Is Better7-Zip Compression 16.02Compress Speed Testhaswellicelake-clientsandybridgeskylaketigerlakex86-645K10K15K20K25KSE +/- 135.50, N = 3SE +/- 45.65, N = 3SE +/- 187.18, N = 3SE +/- 213.82, N = 3SE +/- 172.92, N = 3SE +/- 118.83, N = 32138421003213562129922103209891. (CXX) g++ options: -pipe -lpthread

AOBench

AOBench is a lightweight ambient occlusion renderer, written in C. The test profile is using a size of 2048 x 2048. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterAOBenchSize: 2048 x 2048 - Total Timehaswellicelake-clientsandybridgeskylaketigerlakex86-64714212835SE +/- 0.34, N = 3SE +/- 0.37, N = 3SE +/- 0.36, N = 3SE +/- 0.32, N = 3SE +/- 0.31, N = 3SE +/- 0.21, N = 325.7526.3527.7926.2924.7827.50-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -lm -O3

AOM AV1

This is a simple test of the AOMedia AV1 encoder run on the CPU with a sample video file. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFrames Per Second, More Is BetterAOM AV1 2.0Encoder Mode: Speed 4 Realtimehaswellicelake-clientsandybridgeskylaketigerlakex86-640.19580.39160.58740.78320.979SE +/- 0.00, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 30.810.840.810.830.870.82-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11 -U_FORTIFY_SOURCE -lm -lpthread

OpenBenchmarking.orgFrames Per Second, More Is BetterAOM AV1 2.0Encoder Mode: Speed 5 Two-Passhaswellicelake-clientsandybridgeskylaketigerlakex86-640.63231.26461.89692.52923.1615SE +/- 0.03, N = 9SE +/- 0.03, N = 8SE +/- 0.03, N = 8SE +/- 0.03, N = 8SE +/- 0.02, N = 12SE +/- 0.03, N = 82.672.702.682.702.812.68-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11 -U_FORTIFY_SOURCE -lm -lpthread

OpenBenchmarking.orgFrames Per Second, More Is BetterAOM AV1 2.0Encoder Mode: Speed 8 Realtimehaswellicelake-clientsandybridgeskylaketigerlakex86-641020304050SE +/- 0.35, N = 12SE +/- 0.34, N = 13SE +/- 0.34, N = 13SE +/- 0.35, N = 13SE +/- 0.38, N = 14SE +/- 0.32, N = 1341.8342.1741.9042.5344.1741.75-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11 -U_FORTIFY_SOURCE -lm -lpthread

ASTC Encoder

ASTC Encoder (astcenc) is for the Adaptive Scalable Texture Compression (ASTC) format commonly used with OpenGL, OpenGL ES, and Vulkan graphics APIs. This test profile does a coding test of both compression/decompression. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterASTC Encoder 2.0Preset: Thoroughhaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.22, N = 3SE +/- 0.16, N = 3SE +/- 0.45, N = 3SE +/- 0.33, N = 3SE +/- 0.97, N = 6SE +/- 0.40, N = 385.2585.7684.7885.0481.9685.071. (CXX) g++ options: -std=c++14 -fvisibility=hidden -O3 -flto -mfpmath=sse -mavx2 -mpopcnt -lpthread

OpenBenchmarking.orgSeconds, Fewer Is BetterASTC Encoder 2.0Preset: Exhaustivehaswellicelake-clientsandybridgeskylaketigerlakex86-64160320480640800SE +/- 0.52, N = 3SE +/- 0.86, N = 3SE +/- 0.62, N = 3SE +/- 0.98, N = 3SE +/- 0.34, N = 3SE +/- 0.55, N = 3728.05731.13725.14727.18707.19729.611. (CXX) g++ options: -std=c++14 -fvisibility=hidden -O3 -flto -mfpmath=sse -mavx2 -mpopcnt -lpthread

Bullet Physics Engine

This is a benchmark of the Bullet Physics Engine. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 3000 Fallhaswellicelake-clientsandybridgeskylaketigerlakex86-640.69041.38082.07122.76163.452SE +/- 0.000984, N = 3SE +/- 0.003435, N = 3SE +/- 0.007596, N = 3SE +/- 0.015462, N = 3SE +/- 0.006481, N = 3SE +/- 0.004389, N = 32.8935712.8858203.0441492.8926132.8085053.068488-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 1000 Stackhaswellicelake-clientsandybridgeskylaketigerlakex86-640.77651.5532.32953.1063.8825SE +/- 0.006813, N = 3SE +/- 0.017424, N = 3SE +/- 0.017691, N = 3SE +/- 0.007862, N = 3SE +/- 0.019707, N = 3SE +/- 0.028899, N = 33.1492753.1535003.3970873.2062573.0985353.451086-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 1000 Convexhaswellicelake-clientsandybridgeskylaketigerlakex86-640.77261.54522.31783.09043.863SE +/- 0.002263, N = 3SE +/- 0.012536, N = 3SE +/- 0.009285, N = 3SE +/- 0.002678, N = 3SE +/- 0.014354, N = 3SE +/- 0.003143, N = 33.2607983.2661303.4270653.2906983.2249933.433808-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 136 Ragdollshaswellicelake-clientsandybridgeskylaketigerlakex86-640.42930.85861.28791.71722.1465SE +/- 0.004267, N = 3SE +/- 0.002924, N = 3SE +/- 0.003320, N = 3SE +/- 0.001428, N = 3SE +/- 0.003696, N = 3SE +/- 0.001461, N = 31.7718521.7445331.8980311.7609881.7243821.907845-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: Prim Trimeshhaswellicelake-clientsandybridgeskylaketigerlakex86-640.15510.31020.46530.62040.7755SE +/- 0.001245, N = 3SE +/- 0.002546, N = 3SE +/- 0.000584, N = 3SE +/- 0.000769, N = 3SE +/- 0.000904, N = 3SE +/- 0.000539, N = 30.6363870.6420930.6755670.6410920.6351970.689542-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: Convex Trimeshhaswellicelake-clientsandybridgeskylaketigerlakex86-640.18980.37960.56940.75920.949SE +/- 0.000914, N = 3SE +/- 0.002544, N = 3SE +/- 0.002602, N = 3SE +/- 0.000925, N = 3SE +/- 0.003148, N = 3SE +/- 0.001645, N = 30.7857080.7923520.8371920.7971500.7837800.843420-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

C-Ray

This is a test of C-Ray, a simple raytracer designed to test the floating-point CPU performance. This test is multi-threaded (16 threads per core), will shoot 8 rays per pixel for anti-aliasing, and will generate a 1600 x 1200 image. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterC-Ray 1.1Total Time - 4K, 16 Rays Per Pixelhaswellicelake-clientsandybridgeskylaketigerlakex86-6450100150200250SE +/- 0.53, N = 3SE +/- 0.61, N = 3SE +/- 0.42, N = 3SE +/- 0.28, N = 3SE +/- 0.58, N = 3SE +/- 0.67, N = 3159.43156.66220.65159.13153.13219.71-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -lm -lpthread -O3

CppPerformanceBenchmarks

CppPerformanceBenchmarks is a set of C++ compiler performance benchmarks. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterCppPerformanceBenchmarks 9Test: Atolhaswellicelake-clientsandybridgeskylaketigerlakex86-641020304050SE +/- 0.21, N = 3SE +/- 0.28, N = 3SE +/- 0.26, N = 3SE +/- 0.30, N = 3SE +/- 0.60, N = 4SE +/- 0.36, N = 341.8341.5941.7541.6540.0441.89-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11

OpenBenchmarking.orgSeconds, Fewer Is BetterCppPerformanceBenchmarks 9Test: Math Libraryhaswellicelake-clientsandybridgeskylaketigerlakex86-6450100150200250SE +/- 0.89, N = 3SE +/- 0.52, N = 3SE +/- 0.40, N = 3SE +/- 0.58, N = 3SE +/- 0.85, N = 3SE +/- 0.48, N = 3229.92234.12231.44231.52225.65235.06-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11

OpenBenchmarking.orgSeconds, Fewer Is BetterCppPerformanceBenchmarks 9Test: Stepanov Vectorhaswellicelake-clientsandybridgeskylaketigerlakex86-641632486480SE +/- 0.07, N = 3SE +/- 0.11, N = 3SE +/- 0.09, N = 3SE +/- 0.06, N = 3SE +/- 0.11, N = 3SE +/- 0.27, N = 371.3872.0172.3272.2470.5571.39-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11

dav1d

Dav1d is an open-source, speedy AV1 video decoder. This test profile times how long it takes to decode sample AV1 video content. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Chimera 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-6470140210280350SE +/- 2.38, N = 13SE +/- 2.17, N = 14SE +/- 2.28, N = 13SE +/- 2.13, N = 14SE +/- 2.37, N = 14SE +/- 2.16, N = 14297.97295.30296.44297.51310.73298.17-march=haswell - MIN: 183.29 / MAX: 679.57MIN: 182.34 / MAX: 672.9-march=sandybridge - MIN: 183.11 / MAX: 665.85-march=skylake - MIN: 182.88 / MAX: 673.17-march=tigerlake - MIN: 190.66 / MAX: 684.26-march=x86-64 - MIN: 183.36 / MAX: 680.581. (CC) gcc options: -O3 -pthread

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Summer Nature 4Khaswellicelake-clientsandybridgeskylaketigerlakex86-641632486480SE +/- 0.77, N = 7SE +/- 0.73, N = 7SE +/- 0.74, N = 7SE +/- 0.84, N = 6SE +/- 0.81, N = 7SE +/- 0.84, N = 669.2068.9369.2269.6572.5969.06-march=haswell - MIN: 58.48 / MAX: 122.3MIN: 58.33 / MAX: 121.84-march=sandybridge - MIN: 58.59 / MAX: 121.68-march=skylake - MIN: 58.84 / MAX: 122.74-march=tigerlake - MIN: 61.04 / MAX: 124.62-march=x86-64 - MIN: 58.39 / MAX: 121.771. (CC) gcc options: -O3 -pthread

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Summer Nature 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-6470140210280350SE +/- 2.64, N = 14SE +/- 2.74, N = 13SE +/- 2.61, N = 10SE +/- 2.82, N = 13SE +/- 2.76, N = 13SE +/- 2.20, N = 15293.99291.77290.75295.17307.44292.21-march=haswell - MIN: 231.4 / MAX: 403.75MIN: 229.87 / MAX: 397.85-march=sandybridge - MIN: 223.07 / MAX: 402.56-march=skylake - MIN: 232.72 / MAX: 403-march=tigerlake - MIN: 243.06 / MAX: 407.23-march=x86-64 - MIN: 230.01 / MAX: 398.681. (CC) gcc options: -O3 -pthread

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Chimera 1080p 10-bithaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 1.14, N = 4SE +/- 1.18, N = 4SE +/- 1.30, N = 3SE +/- 1.17, N = 4SE +/- 1.18, N = 4SE +/- 0.91, N = 383.9983.6076.7283.8387.1963.30-march=haswell - MIN: 52.78 / MAX: 272.23MIN: 52.08 / MAX: 270.32-march=sandybridge - MIN: 48.59 / MAX: 245.42-march=skylake - MIN: 52.85 / MAX: 269.19-march=tigerlake - MIN: 54.06 / MAX: 272.51-march=x86-64 - MIN: 40.58 / MAX: 204.761. (CC) gcc options: -O3 -pthread

FFTW

FFTW is a C subroutine library for computing the discrete Fourier transform (DFT) in one or more dimensions. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgMflops, More Is BetterFFTW 3.3.6Build: Stock - Size: 1D FFT Size 4096haswellicelake-clientsandybridgeskylaketigerlakex86-643K6K9K12K15KSE +/- 192.68, N = 3SE +/- 26.19, N = 3SE +/- 81.85, N = 3SE +/- 89.44, N = 3SE +/- 45.43, N = 3SE +/- 89.15, N = 3132481350411708126841382211313-march=haswell-march=skylake-march=tigerlake1. (CC) gcc options: -pthread -O3 -lm

FLAC Audio Encoding

This test times how long it takes to encode a sample WAV file to FLAC format five times. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterFLAC Audio Encoding 1.3.2WAV To FLAChaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.018, N = 5SE +/- 0.019, N = 5SE +/- 0.012, N = 5SE +/- 0.016, N = 5SE +/- 0.022, N = 5SE +/- 0.025, N = 57.3147.1947.5717.2557.1487.648-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -fvisibility=hidden -logg -lm

GraphicsMagick

This is a test of GraphicsMagick with its OpenMP implementation that performs various imaging tests on a sample 6000x4000 pixel JPEG image. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Swirlhaswellicelake-clientsandybridgeskylaketigerlakex86-644080120160200SE +/- 2.50, N = 4SE +/- 2.50, N = 4SE +/- 2.38, N = 5SE +/- 2.36, N = 5SE +/- 1.21, N = 15SE +/- 2.06, N = 5185184178183187169-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Rotatehaswellicelake-clientsandybridgeskylaketigerlakex86-642004006008001000SE +/- 7.69, N = 3SE +/- 15.57, N = 3SE +/- 2.65, N = 3SE +/- 9.33, N = 3SE +/- 13.40, N = 5SE +/- 6.93, N = 39689759969901050995-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Sharpenhaswellicelake-clientsandybridgeskylaketigerlakex86-641428425670SE +/- 0.33, N = 3SE +/- 0.33, N = 3SE +/- 0.58, N = 3SE +/- 0.33, N = 3SE +/- 0.33, N = 3SE +/- 0.33, N = 3616247626446-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Enhancedhaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.67, N = 3SE +/- 0.58, N = 3SE +/- 0.33, N = 3SE +/- 0.33, N = 3SE +/- 0.67, N = 3SE +/- 0.33, N = 3828368758765-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Resizinghaswellicelake-clientsandybridgeskylaketigerlakex86-6480160240320400SE +/- 3.38, N = 3SE +/- 2.91, N = 3SE +/- 2.33, N = 3SE +/- 2.03, N = 3SE +/- 2.73, N = 3SE +/- 1.53, N = 3362364324364382324-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Noise-Gaussianhaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.67, N = 3SE +/- 0.88, N = 3SE +/- 0.67, N = 3SE +/- 1.20, N = 3SE +/- 0.58, N = 3SE +/- 0.67, N = 3929191919490-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: HWB Color Spacehaswellicelake-clientsandybridgeskylaketigerlakex86-64130260390520650SE +/- 4.67, N = 3SE +/- 2.31, N = 3SE +/- 4.81, N = 3SE +/- 5.13, N = 3SE +/- 4.67, N = 3SE +/- 5.36, N = 3540552544544585547-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

Himeno Benchmark

The Himeno benchmark is a linear solver of pressure Poisson using a point-Jacobi method. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgMFLOPS, More Is BetterHimeno Benchmark 3.0Poisson Pressure Solverhaswellicelake-clientsandybridgeskylaketigerlakex86-6412002400360048006000SE +/- 34.45, N = 3SE +/- 22.53, N = 3SE +/- 14.89, N = 3SE +/- 44.96, N = 3SE +/- 20.66, N = 3SE +/- 9.55, N = 35297.245326.054851.755352.225646.734813.21-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -mavx2

Kvazaar

This is a test of Kvazaar as a CPU-based H.265 video encoder written in the C programming language and optimized in Assembly. Kvazaar is the winner of the 2016 ACM Open-Source Software Competition and developed at the Ultra Video Group, Tampere University, Finland. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Slowhaswellicelake-clientsandybridgeskylaketigerlakex86-640.3870.7741.1611.5481.935SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 31.621.671.601.651.721.61-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Mediumhaswellicelake-clientsandybridgeskylaketigerlakex86-640.39150.7831.17451.5661.9575SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 31.641.701.621.681.741.64-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Slowhaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.05, N = 3SE +/- 0.04, N = 3SE +/- 0.03, N = 3SE +/- 0.04, N = 3SE +/- 0.05, N = 3SE +/- 0.04, N = 37.287.507.197.437.747.27-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Mediumhaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.04, N = 3SE +/- 0.04, N = 3SE +/- 0.03, N = 3SE +/- 0.04, N = 3SE +/- 0.06, N = 3SE +/- 0.04, N = 37.467.667.357.627.917.42-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Very Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-641.07332.14663.21994.29325.3665SE +/- 0.01, N = 3SE +/- 0.02, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.02, N = 3SE +/- 0.01, N = 34.504.634.474.614.774.50-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Ultra Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.06, N = 3SE +/- 0.06, N = 3SE +/- 0.06, N = 3SE +/- 0.05, N = 3SE +/- 0.07, N = 3SE +/- 0.04, N = 38.428.588.328.528.898.21-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Very Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.27, N = 3SE +/- 0.28, N = 3SE +/- 0.24, N = 3SE +/- 0.27, N = 3SE +/- 0.31, N = 3SE +/- 0.25, N = 318.8719.3218.6919.2620.0818.77-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Ultra Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-64918273645SE +/- 0.37, N = 8SE +/- 0.34, N = 9SE +/- 0.36, N = 8SE +/- 0.32, N = 10SE +/- 0.37, N = 9SE +/- 0.34, N = 834.9935.6734.5935.2237.2834.29-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

LAME MP3 Encoding

LAME is an MP3 encoder licensed under the LGPL. This test measures the time required to encode a WAV file to MP3 format. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterLAME MP3 Encoding 3.100WAV To MP3haswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.039, N = 3SE +/- 0.035, N = 3SE +/- 0.005, N = 3SE +/- 0.013, N = 3SE +/- 0.018, N = 3SE +/- 0.006, N = 36.3466.3336.4976.3696.2966.649-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -ffast-math -funroll-loops -fschedule-insns2 -fbranch-count-reg -fforce-addr -pipe -lm

LibRaw

LibRaw is a RAW image decoder for digital camera photos. This test profile runs LibRaw's post-processing benchmark. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgMpix/sec, More Is BetterLibRaw 0.20Post-Processing Benchmarkhaswellicelake-clientsandybridgeskylaketigerlakex86-64918273645SE +/- 0.53, N = 15SE +/- 0.83, N = 15SE +/- 0.55, N = 3SE +/- 0.52, N = 3SE +/- 1.13, N = 15SE +/- 0.49, N = 1538.4838.9936.5538.3840.2130.48-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -fopenmp -ljpeg -lz -lm

OpenSSL

OpenSSL is an open-source toolkit that implements SSL (Secure Sockets Layer) and TLS (Transport Layer Security) protocols. This test measures the RSA 4096-bit performance of OpenSSL. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSigns Per Second, More Is BetterOpenSSL 1.1.1RSA 4096-bit Performancehaswellicelake-clientsandybridgeskylaketigerlakex86-642004006008001000SE +/- 9.22, N = 12SE +/- 8.55, N = 14SE +/- 8.76, N = 13SE +/- 7.99, N = 14SE +/- 9.56, N = 13SE +/- 7.34, N = 14898.0892.9899.4892.4927.5892.3-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -m64 -O3 -lssl -lcrypto -ldl

RNNoise

RNNoise is a recurrent neural network for audio noise reduction developed by Mozilla and Xiph.Org. This test profile is a single-threaded test measuring the time to denoise a sample 26 minute long 16-bit RAW audio file using this recurrent neural network noise suppression library. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterRNNoise 2020-06-28haswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.04, N = 3SE +/- 0.03, N = 3SE +/- 0.10, N = 3SE +/- 0.12, N = 3SE +/- 0.10, N = 3SE +/- 0.12, N = 319.3019.3920.1019.5719.2620.60-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -pedantic -fvisibility=hidden

SciMark

This test runs the ANSI C version of SciMark 2.0, which is a benchmark for scientific and numerical computing developed by programmers at the National Institute of Standards and Technology. This test is made up of Fast Foruier Transform, Jacobi Successive Over-relaxation, Monte Carlo, Sparse Matrix Multiply, and dense LU matrix factorization benchmarks. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgMflops, More Is BetterSciMark 2.0Computational Test: Monte Carlohaswellicelake-clientsandybridgeskylaketigerlakex86-642004006008001000SE +/- 24.77, N = 3SE +/- 11.48, N = 3SE +/- 10.83, N = 3SE +/- 14.54, N = 3SE +/- 7.19, N = 3SE +/- 30.84, N = 3922.90975.17933.22922.59980.85916.04-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -lm

OpenBenchmarking.orgMflops, More Is BetterSciMark 2.0Computational Test: Dense LU Matrix Factorizationhaswellicelake-clientsandybridgeskylaketigerlakex86-642K4K6K8K10KSE +/- 76.83, N = 3SE +/- 52.99, N = 3SE +/- 58.99, N = 3SE +/- 66.87, N = 3SE +/- 668.09, N = 3SE +/- 76.86, N = 37453.927524.956807.017448.408249.056130.23-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -lm

SQLite Speedtest

This is a benchmark of SQLite's speedtest1 benchmark program with an increased problem size of 1,000. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterSQLite Speedtest 3.30Timed Time - Size 1,000haswellicelake-clientsandybridgeskylaketigerlakex86-641224364860SE +/- 0.30, N = 3SE +/- 0.39, N = 3SE +/- 0.54, N = 3SE +/- 0.49, N = 3SE +/- 0.42, N = 3SE +/- 0.53, N = 353.0252.4152.2352.3850.5652.33-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -ldl -lz -lpthread

SVT-AV1

This is a test of the Intel Open Visual Cloud Scalable Video Technology SVT-AV1 CPU-based multi-threaded video encoder for the AV1 video format with a sample 1080p YUV video file. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-AV1 0.8Encoder Mode: Enc Mode 4 - Input: 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-640.30290.60580.90871.21161.5145SE +/- 0.008, N = 3SE +/- 0.006, N = 3SE +/- 0.007, N = 3SE +/- 0.008, N = 3SE +/- 0.009, N = 3SE +/- 0.009, N = 31.2891.2881.2911.2911.3461.2861. (CXX) g++ options: -O3 -fcommon -fPIE -fPIC -pie

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-AV1 0.8Encoder Mode: Enc Mode 8 - Input: 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-643691215SE +/- 0.17, N = 3SE +/- 0.16, N = 3SE +/- 0.18, N = 3SE +/- 0.17, N = 3SE +/- 0.17, N = 3SE +/- 0.19, N = 311.4211.4311.4211.4311.8811.381. (CXX) g++ options: -O3 -fcommon -fPIE -fPIC -pie

SVT-VP9

This is a test of the Intel Open Visual Cloud Scalable Video Technology SVT-VP9 CPU-based multi-threaded video encoder for the VP9 video format with a sample 1080p YUV video file. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-VP9 0.1Tuning: PSNR/SSIM Optimized - Input: Bosphorus 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 1.22, N = 13SE +/- 1.22, N = 13SE +/- 1.21, N = 13SE +/- 1.22, N = 13SE +/- 1.62, N = 13SE +/- 1.17, N = 1374.5374.8075.0874.4779.5074.631. (CC) gcc options: -O3 -fcommon -fPIE -fPIC -fvisibility=hidden -pie -rdynamic -lpthread -lrt -lm

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-VP9 0.1Tuning: Visual Quality Optimized - Input: Bosphorus 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-641326395265SE +/- 0.59, N = 13SE +/- 0.60, N = 13SE +/- 0.59, N = 13SE +/- 0.59, N = 13SE +/- 0.75, N = 13SE +/- 0.58, N = 1354.5454.6954.9254.5257.7554.591. (CC) gcc options: -O3 -fcommon -fPIE -fPIC -fvisibility=hidden -pie -rdynamic -lpthread -lrt -lm

Timed Apache Compilation

This test times how long it takes to build the Apache HTTPD web server. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed Apache Compilation 2.4.41Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-64816243240SE +/- 0.45, N = 3SE +/- 0.43, N = 3SE +/- 0.43, N = 3SE +/- 0.46, N = 3SE +/- 0.29, N = 9SE +/- 0.44, N = 332.1732.3731.9531.7331.0131.97

Timed FFmpeg Compilation

This test times how long it takes to build FFmpeg. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed FFmpeg Compilation 4.2.2Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-644080120160200SE +/- 0.34, N = 3SE +/- 0.40, N = 3SE +/- 0.43, N = 3SE +/- 0.43, N = 3SE +/- 0.36, N = 3SE +/- 0.04, N = 3163.83165.08164.23162.48157.49163.78

Timed ImageMagick Compilation

This test times how long it takes to build ImageMagick. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed ImageMagick Compilation 6.9.0Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.56, N = 3SE +/- 0.18, N = 3SE +/- 0.55, N = 3SE +/- 0.34, N = 3SE +/- 1.00, N = 3SE +/- 0.46, N = 381.6382.1482.4582.2878.5682.09

Timed MAFFT Alignment

This test performs an alignment of 100 pyruvate decarboxylase sequences. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed MAFFT Alignment 7.471Multiple Sequence Alignment - LSU RNAhaswellicelake-clientsandybridgeskylaketigerlakex86-643691215SE +/- 0.112, N = 7SE +/- 0.125, N = 5SE +/- 0.146, N = 4SE +/- 0.089, N = 11SE +/- 0.136, N = 12SE +/- 0.144, N = 410.24110.17410.12710.2489.79910.1761. (CC) gcc options: -std=c99 -O3 -lm -lpthread

Timed MPlayer Compilation

This test times how long it takes to build the MPlayer open-source media player program. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed MPlayer Compilation 1.4Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-64306090120150SE +/- 0.38, N = 3SE +/- 0.25, N = 3SE +/- 0.43, N = 3SE +/- 0.40, N = 3SE +/- 0.43, N = 3SE +/- 0.22, N = 3118.01118.34118.44117.00113.77117.75

Timed PHP Compilation

This test times how long it takes to build PHP 7. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed PHP Compilation 7.4.2Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-64306090120150SE +/- 0.46, N = 3SE +/- 0.66, N = 3SE +/- 0.10, N = 3SE +/- 0.17, N = 3SE +/- 0.15, N = 3SE +/- 0.46, N = 3122.94122.51123.38122.16118.22122.09

VP9 libvpx Encoding

This is a standard video encoding performance test of Google's libvpx library and the vpxenc command for the VP9/WebM format using a sample 1080p video. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFrames Per Second, More Is BetterVP9 libvpx Encoding 1.8.2Speed: Speed 0haswellicelake-clientsandybridgeskylaketigerlakex86-641.3232.6463.9695.2926.615SE +/- 0.04, N = 3SE +/- 0.02, N = 3SE +/- 0.01, N = 3SE +/- 0.04, N = 3SE +/- 0.04, N = 3SE +/- 0.04, N = 35.485.595.385.545.885.25-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -m64 -lm -lpthread -O3 -fPIC -U_FORTIFY_SOURCE -std=c++11

OpenBenchmarking.orgFrames Per Second, More Is BetterVP9 libvpx Encoding 1.8.2Speed: Speed 5haswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.09, N = 3SE +/- 0.20, N = 3SE +/- 0.26, N = 3SE +/- 0.22, N = 3SE +/- 0.35, N = 3SE +/- 0.24, N = 520.1220.7019.0120.3622.2118.29-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -m64 -lm -lpthread -O3 -fPIC -U_FORTIFY_SOURCE -std=c++11

x264

This is a simple test of the x264 encoder run on the CPU (OpenCL support disabled) with a sample video file. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFrames Per Second, More Is Betterx264 2019-12-17H.264 Video Encodinghaswellicelake-clientsandybridgeskylaketigerlakex86-64816243240SE +/- 0.45, N = 4SE +/- 0.44, N = 4SE +/- 0.42, N = 4SE +/- 0.43, N = 4SE +/- 0.46, N = 5SE +/- 0.46, N = 432.9533.1533.0033.1134.6833.00-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -ldl -lavformat -lavcodec -lavutil -lswscale -m64 -lm -lpthread -O3 -ffast-math -std=gnu99 -fPIC -fomit-frame-pointer -fno-tree-vectorize

x265

This is a simple test of the x265 encoder run on the CPU with 1080p and 4K options for H.265 video encode performance with x265. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgFrames Per Second, More Is Betterx265 3.4Video Input: Bosphorus 4Khaswellicelake-clientsandybridgeskylaketigerlakex86-641.21052.4213.63154.8426.0525SE +/- 0.02, N = 3SE +/- 0.03, N = 3SE +/- 0.03, N = 3SE +/- 0.01, N = 3SE +/- 0.03, N = 3SE +/- 0.03, N = 35.245.215.275.275.385.30-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lpthread -lrt -ldl -lnuma

OpenBenchmarking.orgFrames Per Second, More Is Betterx265 3.4Video Input: Bosphorus 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-64612182430SE +/- 0.38, N = 3SE +/- 0.39, N = 3SE +/- 0.41, N = 3SE +/- 0.35, N = 4SE +/- 0.30, N = 5SE +/- 0.41, N = 324.6424.5024.6724.8125.2524.87-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lpthread -lrt -ldl -lnuma

XZ Compression

This test measures the time needed to compress a sample file (an Ubuntu file-system image) using XZ compression. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgSeconds, Fewer Is BetterXZ Compression 5.2.4Compressing ubuntu-16.04.3-server-i386.img, Compression Level 9haswellicelake-clientsandybridgeskylaketigerlakex86-641428425670SE +/- 0.94, N = 3SE +/- 0.21, N = 3SE +/- 0.74, N = 5SE +/- 0.71, N = 3SE +/- 0.82, N = 3SE +/- 0.80, N = 461.0259.7660.2760.5458.0059.77-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -fvisibility=hidden -O3

Zstd Compression

This test measures the time needed to compress a sample file (an Ubuntu ISO) using Zstd compression. Learn more via the OpenBenchmarking.org test page.

OpenBenchmarking.orgMB/s, More Is BetterZstd Compression 1.4.5Compression Level: 3haswellicelake-clientsandybridgeskylaketigerlakex86-649001800270036004500SE +/- 7.89, N = 3SE +/- 11.03, N = 3SE +/- 11.42, N = 3SE +/- 9.03, N = 3SE +/- 4.05, N = 3SE +/- 3.03, N = 34056.04021.03923.44035.34111.03896.4-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -pthread -lz -llzma

OpenBenchmarking.orgMB/s, More Is BetterZstd Compression 1.4.5Compression Level: 19haswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.06, N = 3SE +/- 0.10, N = 3SE +/- 0.09, N = 3SE +/- 0.17, N = 3SE +/- 0.12, N = 3SE +/- 0.03, N = 321.921.821.721.822.522.1-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -pthread -lz -llzma