Tigerlake GCC 11 Compiler Optimization Benchmarks

Tests for a future article by Michael Larabel.

HTML result view exported from: https://openbenchmarking.org/result/2011033-FI-TIGERLAKE42&sro&grw.

Tigerlake GCC 11 Compiler Optimization BenchmarksProcessorMotherboardChipsetMemoryDiskGraphicsAudioNetworkOSKernelDesktopDisplay ServerDisplay DriverOpenGLOpenCLVulkanCompilerFile-SystemScreen Resolutionx86-64sandybridgehaswellskylakeicelake-clienttigerlakeIntel Core i7-1165G7 @ 4.70GHz (4 Cores / 8 Threads)Dell 0GG9PT (1.0.3 BIOS)Intel Tiger Lake-LP16GBKioxia KBG40ZNS256G NVMe 256GBIntel UHD 3GB (1300MHz)Realtek ALC289Intel Wi-Fi 6 AX201Ubuntu 20.105.10.0-051000rc1daily20201029-generic (x86_64) 20201028GNOME Shell 3.38.1X Server 1.20.9modesetting 1.20.94.6 Mesa 20.2.1OpenCL 3.01.2.145GCC 11.0.0 20201025ext41920x1200OpenBenchmarking.orgEnvironment Details- x86-64: CXXFLAGS="-O3 -march=x86-64" CFLAGS="-O3 -march=x86-64"- sandybridge: CXXFLAGS="-O3 -march=sandybridge" CFLAGS="-O3 -march=sandybridge"- haswell: CXXFLAGS="-O3 -march=haswell" CFLAGS="-O3 -march=haswell"- skylake: CXXFLAGS="-O3 -march=skylake" CFLAGS="-O3 -march=skylake"- icelake-client: CXXFLAGS="-O3 -march=icelake-client" CFLAGS="-O3 -march=icelake-client"- tigerlake: CXXFLAGS="-O3 -march=tigerlake" CFLAGS="-O3 -march=tigerlake"Compiler Details- --disable-multilib --enable-checking=releaseProcessor Details- Scaling Governor: intel_pstate powersave - CPU Microcode: 0x60 - Thermald 2.3Security Details- itlb_multihit: Not affected + l1tf: Not affected + mds: Not affected + meltdown: Not affected + spec_store_bypass: Mitigation of SSB disabled via prctl and seccomp + spectre_v1: Mitigation of usercopy/swapgs barriers and __user pointer sanitization + spectre_v2: Mitigation of Enhanced IBRS IBPB: conditional RSB filling + srbds: Not affected + tsx_async_abort: Not affected Python Details- tigerlake: Python 3.8.6

Tigerlake GCC 11 Compiler Optimization Benchmarksbullet: 3000 Fallbullet: 1000 Stackbullet: 1000 Convexbullet: 136 Ragdollsbullet: Prim Trimeshbullet: Convex Trimeshscimark2: Monte Carloscimark2: Dense LU Matrix Factorizationcompress-xz: Compressing ubuntu-16.04.3-server-i386.img, Compression Level 9cpp-perf-bench: Atolcpp-perf-bench: Math Librarycpp-perf-bench: Stepanov Vectorencode-flac: WAV To FLACencode-mp3: WAV To MP3astcenc: Thoroughastcenc: Exhaustivelibraw: Post-Processing Benchmarkfftw: Stock - 1D FFT Size 4096mafft: Multiple Sequence Alignment - LSU RNAhimeno: Poisson Pressure Solverrnnoise: build-ffmpeg: Time To Compilebuild-imagemagick: Time To Compilebuild-mplayer: Time To Compilebuild-apache: Time To Compilecompress-7zip: Compress Speed Testbuild-php: Time To Compilecompress-zstd: 3compress-zstd: 19kvazaar: Bosphorus 4K - Slowkvazaar: Bosphorus 4K - Mediumkvazaar: Bosphorus 1080p - Slowkvazaar: Bosphorus 1080p - Mediumkvazaar: Bosphorus 4K - Very Fastkvazaar: Bosphorus 4K - Ultra Fastkvazaar: Bosphorus 1080p - Very Fastkvazaar: Bosphorus 1080p - Ultra Fastaom-av1: Speed 4 Realtimeaom-av1: Speed 5 Two-Passaom-av1: Speed 8 Realtimeaobench: 2048 x 2048 - Total Timevpxenc: Speed 0vpxenc: Speed 5graphics-magick: Swirlgraphics-magick: Rotategraphics-magick: Sharpengraphics-magick: Enhancedgraphics-magick: Resizinggraphics-magick: Noise-Gaussiangraphics-magick: HWB Color Spacesvt-vp9: PSNR/SSIM Optimized - Bosphorus 1080psvt-vp9: Visual Quality Optimized - Bosphorus 1080px264: H.264 Video Encodingdav1d: Chimera 1080pdav1d: Summer Nature 4Kdav1d: Summer Nature 1080pdav1d: Chimera 1080p 10-bitsvt-av1: Enc Mode 4 - 1080psvt-av1: Enc Mode 8 - 1080px265: Bosphorus 4Kx265: Bosphorus 1080pc-ray: Total Time - 4K, 16 Rays Per Pixelopenssl: RSA 4096-bit Performancesqlite-speedtest: Timed Time - Size 1,000x86-64sandybridgehaswellskylakeicelake-clienttigerlake3.0684883.4510863.4338081.9078450.6895420.843420916.046130.2359.76941.885235.05571.3897.6486.64985.07729.6130.481131310.1764813.20504220.596163.78382.093117.75131.97020989122.0933896.422.11.611.647.277.424.508.2118.7734.290.822.6841.7527.4965.2518.2916999546653249054774.6354.5933.00298.1769.06292.2163.301.28611.3785.3024.87219.706892.352.3313.0441493.3970873.4270651.8980310.6755670.837192933.226807.0160.26741.751231.43572.3247.5716.49784.78725.1436.551170810.1274851.74587520.103164.23082.452118.43931.95421356123.3783923.421.71.61.627.197.354.478.3218.6934.590.812.6841.9027.7885.3819.0117899647683249154475.0854.9233.00296.4469.22290.7576.721.29111.4235.2724.67220.646899.452.2312.8935713.1492753.2607981.7718520.6363870.785708922.907453.9261.02341.828229.91671.3787.3146.34685.25728.0538.481324810.2415297.24498619.303163.82581.627118.01132.17421384122.9394056.021.91.621.647.287.464.508.4218.8734.990.812.6741.8325.7475.4820.1218596861823629254074.5354.5432.95297.9769.20293.9983.991.28911.4225.2424.64159.431898.053.0242.8926133.2062573.2906981.7609880.6410920.797150922.597448.4060.54241.651231.51672.2427.2556.36985.04727.1838.381268410.2485352.22070219.571162.47682.278117.00131.72721299122.1564035.321.81.651.687.437.624.618.5219.2635.220.832.7042.5326.2855.5420.3618399062753649154474.4754.5233.11297.5169.65295.1783.831.29111.4325.2724.81159.130892.452.3812.885823.1535003.2661301.7445330.6420930.792352975.177524.9559.76041.594234.11572.0107.1946.33385.76731.1338.991350410.1745326.05022519.389165.07982.140118.34332.37221003122.5054021.021.81.671.707.507.664.638.5819.3235.670.842.7042.1726.3535.5920.7018497562833649155274.8054.6933.15295.3068.93291.7783.601.28811.4285.2124.50156.659892.952.4112.8085053.0985353.2249931.7243820.6351970.78378980.858249.0557.99540.038225.64970.5477.1486.29681.96707.1940.21138229.7995646.73174719.261157.49378.561113.76831.01422103118.2184111.022.51.721.747.747.914.778.8920.0837.280.872.8144.1724.7835.8822.21187105064873829458579.5057.7534.68310.7372.59307.4487.191.34611.8805.3825.25153.127927.550.564OpenBenchmarking.org

Bullet Physics Engine

Test: 3000 Fall

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 3000 Fallhaswellicelake-clientsandybridgeskylaketigerlakex86-640.69041.38082.07122.76163.452SE +/- 0.000984, N = 3SE +/- 0.003435, N = 3SE +/- 0.007596, N = 3SE +/- 0.015462, N = 3SE +/- 0.006481, N = 3SE +/- 0.004389, N = 32.8935712.8858203.0441492.8926132.8085053.068488-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

Bullet Physics Engine

Test: 1000 Stack

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 1000 Stackhaswellicelake-clientsandybridgeskylaketigerlakex86-640.77651.5532.32953.1063.8825SE +/- 0.006813, N = 3SE +/- 0.017424, N = 3SE +/- 0.017691, N = 3SE +/- 0.007862, N = 3SE +/- 0.019707, N = 3SE +/- 0.028899, N = 33.1492753.1535003.3970873.2062573.0985353.451086-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

Bullet Physics Engine

Test: 1000 Convex

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 1000 Convexhaswellicelake-clientsandybridgeskylaketigerlakex86-640.77261.54522.31783.09043.863SE +/- 0.002263, N = 3SE +/- 0.012536, N = 3SE +/- 0.009285, N = 3SE +/- 0.002678, N = 3SE +/- 0.014354, N = 3SE +/- 0.003143, N = 33.2607983.2661303.4270653.2906983.2249933.433808-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

Bullet Physics Engine

Test: 136 Ragdolls

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: 136 Ragdollshaswellicelake-clientsandybridgeskylaketigerlakex86-640.42930.85861.28791.71722.1465SE +/- 0.004267, N = 3SE +/- 0.002924, N = 3SE +/- 0.003320, N = 3SE +/- 0.001428, N = 3SE +/- 0.003696, N = 3SE +/- 0.001461, N = 31.7718521.7445331.8980311.7609881.7243821.907845-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

Bullet Physics Engine

Test: Prim Trimesh

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: Prim Trimeshhaswellicelake-clientsandybridgeskylaketigerlakex86-640.15510.31020.46530.62040.7755SE +/- 0.001245, N = 3SE +/- 0.002546, N = 3SE +/- 0.000584, N = 3SE +/- 0.000769, N = 3SE +/- 0.000904, N = 3SE +/- 0.000539, N = 30.6363870.6420930.6755670.6410920.6351970.689542-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

Bullet Physics Engine

Test: Convex Trimesh

OpenBenchmarking.orgSeconds, Fewer Is BetterBullet Physics Engine 2.81Test: Convex Trimeshhaswellicelake-clientsandybridgeskylaketigerlakex86-640.18980.37960.56940.75920.949SE +/- 0.000914, N = 3SE +/- 0.002544, N = 3SE +/- 0.002602, N = 3SE +/- 0.000925, N = 3SE +/- 0.003148, N = 3SE +/- 0.001645, N = 30.7857080.7923520.8371920.7971500.7837800.843420-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lglut -lGL -lGLU

SciMark

Computational Test: Monte Carlo

OpenBenchmarking.orgMflops, More Is BetterSciMark 2.0Computational Test: Monte Carlohaswellicelake-clientsandybridgeskylaketigerlakex86-642004006008001000SE +/- 24.77, N = 3SE +/- 11.48, N = 3SE +/- 10.83, N = 3SE +/- 14.54, N = 3SE +/- 7.19, N = 3SE +/- 30.84, N = 3922.90975.17933.22922.59980.85916.04-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -lm

SciMark

Computational Test: Dense LU Matrix Factorization

OpenBenchmarking.orgMflops, More Is BetterSciMark 2.0Computational Test: Dense LU Matrix Factorizationhaswellicelake-clientsandybridgeskylaketigerlakex86-642K4K6K8K10KSE +/- 76.83, N = 3SE +/- 52.99, N = 3SE +/- 58.99, N = 3SE +/- 66.87, N = 3SE +/- 668.09, N = 3SE +/- 76.86, N = 37453.927524.956807.017448.408249.056130.23-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -lm

XZ Compression

Compressing ubuntu-16.04.3-server-i386.img, Compression Level 9

OpenBenchmarking.orgSeconds, Fewer Is BetterXZ Compression 5.2.4Compressing ubuntu-16.04.3-server-i386.img, Compression Level 9haswellicelake-clientsandybridgeskylaketigerlakex86-641428425670SE +/- 0.94, N = 3SE +/- 0.21, N = 3SE +/- 0.74, N = 5SE +/- 0.71, N = 3SE +/- 0.82, N = 3SE +/- 0.80, N = 461.0259.7660.2760.5458.0059.77-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -fvisibility=hidden -O3

CppPerformanceBenchmarks

Test: Atol

OpenBenchmarking.orgSeconds, Fewer Is BetterCppPerformanceBenchmarks 9Test: Atolhaswellicelake-clientsandybridgeskylaketigerlakex86-641020304050SE +/- 0.21, N = 3SE +/- 0.28, N = 3SE +/- 0.26, N = 3SE +/- 0.30, N = 3SE +/- 0.60, N = 4SE +/- 0.36, N = 341.8341.5941.7541.6540.0441.89-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11

CppPerformanceBenchmarks

Test: Math Library

OpenBenchmarking.orgSeconds, Fewer Is BetterCppPerformanceBenchmarks 9Test: Math Libraryhaswellicelake-clientsandybridgeskylaketigerlakex86-6450100150200250SE +/- 0.89, N = 3SE +/- 0.52, N = 3SE +/- 0.40, N = 3SE +/- 0.58, N = 3SE +/- 0.85, N = 3SE +/- 0.48, N = 3229.92234.12231.44231.52225.65235.06-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11

CppPerformanceBenchmarks

Test: Stepanov Vector

OpenBenchmarking.orgSeconds, Fewer Is BetterCppPerformanceBenchmarks 9Test: Stepanov Vectorhaswellicelake-clientsandybridgeskylaketigerlakex86-641632486480SE +/- 0.07, N = 3SE +/- 0.11, N = 3SE +/- 0.09, N = 3SE +/- 0.06, N = 3SE +/- 0.11, N = 3SE +/- 0.27, N = 371.3872.0172.3272.2470.5571.39-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11

FLAC Audio Encoding

WAV To FLAC

OpenBenchmarking.orgSeconds, Fewer Is BetterFLAC Audio Encoding 1.3.2WAV To FLAChaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.018, N = 5SE +/- 0.019, N = 5SE +/- 0.012, N = 5SE +/- 0.016, N = 5SE +/- 0.022, N = 5SE +/- 0.025, N = 57.3147.1947.5717.2557.1487.648-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -fvisibility=hidden -logg -lm

LAME MP3 Encoding

WAV To MP3

OpenBenchmarking.orgSeconds, Fewer Is BetterLAME MP3 Encoding 3.100WAV To MP3haswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.039, N = 3SE +/- 0.035, N = 3SE +/- 0.005, N = 3SE +/- 0.013, N = 3SE +/- 0.018, N = 3SE +/- 0.006, N = 36.3466.3336.4976.3696.2966.649-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -ffast-math -funroll-loops -fschedule-insns2 -fbranch-count-reg -fforce-addr -pipe -lm

ASTC Encoder

Preset: Thorough

OpenBenchmarking.orgSeconds, Fewer Is BetterASTC Encoder 2.0Preset: Thoroughhaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.22, N = 3SE +/- 0.16, N = 3SE +/- 0.45, N = 3SE +/- 0.33, N = 3SE +/- 0.97, N = 6SE +/- 0.40, N = 385.2585.7684.7885.0481.9685.071. (CXX) g++ options: -std=c++14 -fvisibility=hidden -O3 -flto -mfpmath=sse -mavx2 -mpopcnt -lpthread

ASTC Encoder

Preset: Exhaustive

OpenBenchmarking.orgSeconds, Fewer Is BetterASTC Encoder 2.0Preset: Exhaustivehaswellicelake-clientsandybridgeskylaketigerlakex86-64160320480640800SE +/- 0.52, N = 3SE +/- 0.86, N = 3SE +/- 0.62, N = 3SE +/- 0.98, N = 3SE +/- 0.34, N = 3SE +/- 0.55, N = 3728.05731.13725.14727.18707.19729.611. (CXX) g++ options: -std=c++14 -fvisibility=hidden -O3 -flto -mfpmath=sse -mavx2 -mpopcnt -lpthread

LibRaw

Post-Processing Benchmark

OpenBenchmarking.orgMpix/sec, More Is BetterLibRaw 0.20Post-Processing Benchmarkhaswellicelake-clientsandybridgeskylaketigerlakex86-64918273645SE +/- 0.53, N = 15SE +/- 0.83, N = 15SE +/- 0.55, N = 3SE +/- 0.52, N = 3SE +/- 1.13, N = 15SE +/- 0.49, N = 1538.4838.9936.5538.3840.2130.48-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -fopenmp -ljpeg -lz -lm

FFTW

Build: Stock - Size: 1D FFT Size 4096

OpenBenchmarking.orgMflops, More Is BetterFFTW 3.3.6Build: Stock - Size: 1D FFT Size 4096haswellicelake-clientsandybridgeskylaketigerlakex86-643K6K9K12K15KSE +/- 192.68, N = 3SE +/- 26.19, N = 3SE +/- 81.85, N = 3SE +/- 89.44, N = 3SE +/- 45.43, N = 3SE +/- 89.15, N = 3132481350411708126841382211313-march=haswell-march=skylake-march=tigerlake1. (CC) gcc options: -pthread -O3 -lm

Timed MAFFT Alignment

Multiple Sequence Alignment - LSU RNA

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed MAFFT Alignment 7.471Multiple Sequence Alignment - LSU RNAhaswellicelake-clientsandybridgeskylaketigerlakex86-643691215SE +/- 0.112, N = 7SE +/- 0.125, N = 5SE +/- 0.146, N = 4SE +/- 0.089, N = 11SE +/- 0.136, N = 12SE +/- 0.144, N = 410.24110.17410.12710.2489.79910.1761. (CC) gcc options: -std=c99 -O3 -lm -lpthread

Himeno Benchmark

Poisson Pressure Solver

OpenBenchmarking.orgMFLOPS, More Is BetterHimeno Benchmark 3.0Poisson Pressure Solverhaswellicelake-clientsandybridgeskylaketigerlakex86-6412002400360048006000SE +/- 34.45, N = 3SE +/- 22.53, N = 3SE +/- 14.89, N = 3SE +/- 44.96, N = 3SE +/- 20.66, N = 3SE +/- 9.55, N = 35297.245326.054851.755352.225646.734813.21-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -mavx2

RNNoise

OpenBenchmarking.orgSeconds, Fewer Is BetterRNNoise 2020-06-28haswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.04, N = 3SE +/- 0.03, N = 3SE +/- 0.10, N = 3SE +/- 0.12, N = 3SE +/- 0.10, N = 3SE +/- 0.12, N = 319.3019.3920.1019.5719.2620.60-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -pedantic -fvisibility=hidden

Timed FFmpeg Compilation

Time To Compile

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed FFmpeg Compilation 4.2.2Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-644080120160200SE +/- 0.34, N = 3SE +/- 0.40, N = 3SE +/- 0.43, N = 3SE +/- 0.43, N = 3SE +/- 0.36, N = 3SE +/- 0.04, N = 3163.83165.08164.23162.48157.49163.78

Timed ImageMagick Compilation

Time To Compile

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed ImageMagick Compilation 6.9.0Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.56, N = 3SE +/- 0.18, N = 3SE +/- 0.55, N = 3SE +/- 0.34, N = 3SE +/- 1.00, N = 3SE +/- 0.46, N = 381.6382.1482.4582.2878.5682.09

Timed MPlayer Compilation

Time To Compile

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed MPlayer Compilation 1.4Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-64306090120150SE +/- 0.38, N = 3SE +/- 0.25, N = 3SE +/- 0.43, N = 3SE +/- 0.40, N = 3SE +/- 0.43, N = 3SE +/- 0.22, N = 3118.01118.34118.44117.00113.77117.75

Timed Apache Compilation

Time To Compile

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed Apache Compilation 2.4.41Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-64816243240SE +/- 0.45, N = 3SE +/- 0.43, N = 3SE +/- 0.43, N = 3SE +/- 0.46, N = 3SE +/- 0.29, N = 9SE +/- 0.44, N = 332.1732.3731.9531.7331.0131.97

7-Zip Compression

Compress Speed Test

OpenBenchmarking.orgMIPS, More Is Better7-Zip Compression 16.02Compress Speed Testhaswellicelake-clientsandybridgeskylaketigerlakex86-645K10K15K20K25KSE +/- 135.50, N = 3SE +/- 45.65, N = 3SE +/- 187.18, N = 3SE +/- 213.82, N = 3SE +/- 172.92, N = 3SE +/- 118.83, N = 32138421003213562129922103209891. (CXX) g++ options: -pipe -lpthread

Timed PHP Compilation

Time To Compile

OpenBenchmarking.orgSeconds, Fewer Is BetterTimed PHP Compilation 7.4.2Time To Compilehaswellicelake-clientsandybridgeskylaketigerlakex86-64306090120150SE +/- 0.46, N = 3SE +/- 0.66, N = 3SE +/- 0.10, N = 3SE +/- 0.17, N = 3SE +/- 0.15, N = 3SE +/- 0.46, N = 3122.94122.51123.38122.16118.22122.09

Zstd Compression

Compression Level: 3

OpenBenchmarking.orgMB/s, More Is BetterZstd Compression 1.4.5Compression Level: 3haswellicelake-clientsandybridgeskylaketigerlakex86-649001800270036004500SE +/- 7.89, N = 3SE +/- 11.03, N = 3SE +/- 11.42, N = 3SE +/- 9.03, N = 3SE +/- 4.05, N = 3SE +/- 3.03, N = 34056.04021.03923.44035.34111.03896.4-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -pthread -lz -llzma

Zstd Compression

Compression Level: 19

OpenBenchmarking.orgMB/s, More Is BetterZstd Compression 1.4.5Compression Level: 19haswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.06, N = 3SE +/- 0.10, N = 3SE +/- 0.09, N = 3SE +/- 0.17, N = 3SE +/- 0.12, N = 3SE +/- 0.03, N = 321.921.821.721.822.522.1-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -pthread -lz -llzma

Kvazaar

Video Input: Bosphorus 4K - Video Preset: Slow

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Slowhaswellicelake-clientsandybridgeskylaketigerlakex86-640.3870.7741.1611.5481.935SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 31.621.671.601.651.721.61-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

Kvazaar

Video Input: Bosphorus 4K - Video Preset: Medium

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Mediumhaswellicelake-clientsandybridgeskylaketigerlakex86-640.39150.7831.17451.5661.9575SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 3SE +/- 0.00, N = 31.641.701.621.681.741.64-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

Kvazaar

Video Input: Bosphorus 1080p - Video Preset: Slow

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Slowhaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.05, N = 3SE +/- 0.04, N = 3SE +/- 0.03, N = 3SE +/- 0.04, N = 3SE +/- 0.05, N = 3SE +/- 0.04, N = 37.287.507.197.437.747.27-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

Kvazaar

Video Input: Bosphorus 1080p - Video Preset: Medium

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Mediumhaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.04, N = 3SE +/- 0.04, N = 3SE +/- 0.03, N = 3SE +/- 0.04, N = 3SE +/- 0.06, N = 3SE +/- 0.04, N = 37.467.667.357.627.917.42-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

Kvazaar

Video Input: Bosphorus 4K - Video Preset: Very Fast

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Very Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-641.07332.14663.21994.29325.3665SE +/- 0.01, N = 3SE +/- 0.02, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.02, N = 3SE +/- 0.01, N = 34.504.634.474.614.774.50-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

Kvazaar

Video Input: Bosphorus 4K - Video Preset: Ultra Fast

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 4K - Video Preset: Ultra Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-64246810SE +/- 0.06, N = 3SE +/- 0.06, N = 3SE +/- 0.06, N = 3SE +/- 0.05, N = 3SE +/- 0.07, N = 3SE +/- 0.04, N = 38.428.588.328.528.898.21-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

Kvazaar

Video Input: Bosphorus 1080p - Video Preset: Very Fast

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Very Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.27, N = 3SE +/- 0.28, N = 3SE +/- 0.24, N = 3SE +/- 0.27, N = 3SE +/- 0.31, N = 3SE +/- 0.25, N = 318.8719.3218.6919.2620.0818.77-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

Kvazaar

Video Input: Bosphorus 1080p - Video Preset: Ultra Fast

OpenBenchmarking.orgFrames Per Second, More Is BetterKvazaar 2.0Video Input: Bosphorus 1080p - Video Preset: Ultra Fasthaswellicelake-clientsandybridgeskylaketigerlakex86-64918273645SE +/- 0.37, N = 8SE +/- 0.34, N = 9SE +/- 0.36, N = 8SE +/- 0.32, N = 10SE +/- 0.37, N = 9SE +/- 0.34, N = 834.9935.6734.5935.2237.2834.29-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -ftree-vectorize -fvisibility=hidden -O3 -lpthread -lm -lrt

AOM AV1

Encoder Mode: Speed 4 Realtime

OpenBenchmarking.orgFrames Per Second, More Is BetterAOM AV1 2.0Encoder Mode: Speed 4 Realtimehaswellicelake-clientsandybridgeskylaketigerlakex86-640.19580.39160.58740.78320.979SE +/- 0.00, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 3SE +/- 0.01, N = 30.810.840.810.830.870.82-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11 -U_FORTIFY_SOURCE -lm -lpthread

AOM AV1

Encoder Mode: Speed 5 Two-Pass

OpenBenchmarking.orgFrames Per Second, More Is BetterAOM AV1 2.0Encoder Mode: Speed 5 Two-Passhaswellicelake-clientsandybridgeskylaketigerlakex86-640.63231.26461.89692.52923.1615SE +/- 0.03, N = 9SE +/- 0.03, N = 8SE +/- 0.03, N = 8SE +/- 0.03, N = 8SE +/- 0.02, N = 12SE +/- 0.03, N = 82.672.702.682.702.812.68-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11 -U_FORTIFY_SOURCE -lm -lpthread

AOM AV1

Encoder Mode: Speed 8 Realtime

OpenBenchmarking.orgFrames Per Second, More Is BetterAOM AV1 2.0Encoder Mode: Speed 8 Realtimehaswellicelake-clientsandybridgeskylaketigerlakex86-641020304050SE +/- 0.35, N = 12SE +/- 0.34, N = 13SE +/- 0.34, N = 13SE +/- 0.35, N = 13SE +/- 0.38, N = 14SE +/- 0.32, N = 1341.8342.1741.9042.5344.1741.75-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -std=c++11 -U_FORTIFY_SOURCE -lm -lpthread

AOBench

Size: 2048 x 2048 - Total Time

OpenBenchmarking.orgSeconds, Fewer Is BetterAOBenchSize: 2048 x 2048 - Total Timehaswellicelake-clientsandybridgeskylaketigerlakex86-64714212835SE +/- 0.34, N = 3SE +/- 0.37, N = 3SE +/- 0.36, N = 3SE +/- 0.32, N = 3SE +/- 0.31, N = 3SE +/- 0.21, N = 325.7526.3527.7926.2924.7827.50-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -lm -O3

VP9 libvpx Encoding

Speed: Speed 0

OpenBenchmarking.orgFrames Per Second, More Is BetterVP9 libvpx Encoding 1.8.2Speed: Speed 0haswellicelake-clientsandybridgeskylaketigerlakex86-641.3232.6463.9695.2926.615SE +/- 0.04, N = 3SE +/- 0.02, N = 3SE +/- 0.01, N = 3SE +/- 0.04, N = 3SE +/- 0.04, N = 3SE +/- 0.04, N = 35.485.595.385.545.885.25-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -m64 -lm -lpthread -O3 -fPIC -U_FORTIFY_SOURCE -std=c++11

VP9 libvpx Encoding

Speed: Speed 5

OpenBenchmarking.orgFrames Per Second, More Is BetterVP9 libvpx Encoding 1.8.2Speed: Speed 5haswellicelake-clientsandybridgeskylaketigerlakex86-64510152025SE +/- 0.09, N = 3SE +/- 0.20, N = 3SE +/- 0.26, N = 3SE +/- 0.22, N = 3SE +/- 0.35, N = 3SE +/- 0.24, N = 520.1220.7019.0120.3622.2118.29-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -m64 -lm -lpthread -O3 -fPIC -U_FORTIFY_SOURCE -std=c++11

GraphicsMagick

Operation: Swirl

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Swirlhaswellicelake-clientsandybridgeskylaketigerlakex86-644080120160200SE +/- 2.50, N = 4SE +/- 2.50, N = 4SE +/- 2.38, N = 5SE +/- 2.36, N = 5SE +/- 1.21, N = 15SE +/- 2.06, N = 5185184178183187169-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

GraphicsMagick

Operation: Rotate

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Rotatehaswellicelake-clientsandybridgeskylaketigerlakex86-642004006008001000SE +/- 7.69, N = 3SE +/- 15.57, N = 3SE +/- 2.65, N = 3SE +/- 9.33, N = 3SE +/- 13.40, N = 5SE +/- 6.93, N = 39689759969901050995-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

GraphicsMagick

Operation: Sharpen

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Sharpenhaswellicelake-clientsandybridgeskylaketigerlakex86-641428425670SE +/- 0.33, N = 3SE +/- 0.33, N = 3SE +/- 0.58, N = 3SE +/- 0.33, N = 3SE +/- 0.33, N = 3SE +/- 0.33, N = 3616247626446-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

GraphicsMagick

Operation: Enhanced

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Enhancedhaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.67, N = 3SE +/- 0.58, N = 3SE +/- 0.33, N = 3SE +/- 0.33, N = 3SE +/- 0.67, N = 3SE +/- 0.33, N = 3828368758765-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

GraphicsMagick

Operation: Resizing

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Resizinghaswellicelake-clientsandybridgeskylaketigerlakex86-6480160240320400SE +/- 3.38, N = 3SE +/- 2.91, N = 3SE +/- 2.33, N = 3SE +/- 2.03, N = 3SE +/- 2.73, N = 3SE +/- 1.53, N = 3362364324364382324-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

GraphicsMagick

Operation: Noise-Gaussian

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: Noise-Gaussianhaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 0.67, N = 3SE +/- 0.88, N = 3SE +/- 0.67, N = 3SE +/- 1.20, N = 3SE +/- 0.58, N = 3SE +/- 0.67, N = 3929191919490-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

GraphicsMagick

Operation: HWB Color Space

OpenBenchmarking.orgIterations Per Minute, More Is BetterGraphicsMagick 1.3.33Operation: HWB Color Spacehaswellicelake-clientsandybridgeskylaketigerlakex86-64130260390520650SE +/- 4.67, N = 3SE +/- 2.31, N = 3SE +/- 4.81, N = 3SE +/- 5.13, N = 3SE +/- 4.67, N = 3SE +/- 5.36, N = 3540552544544585547-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -fopenmp -O3 -pthread -ljbig -lwebp -lwebpmux -ltiff -ljpeg -lXext -lSM -lICE -lX11 -llzma -lxml2 -lz -lm -lpthread

SVT-VP9

Tuning: PSNR/SSIM Optimized - Input: Bosphorus 1080p

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-VP9 0.1Tuning: PSNR/SSIM Optimized - Input: Bosphorus 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 1.22, N = 13SE +/- 1.22, N = 13SE +/- 1.21, N = 13SE +/- 1.22, N = 13SE +/- 1.62, N = 13SE +/- 1.17, N = 1374.5374.8075.0874.4779.5074.631. (CC) gcc options: -O3 -fcommon -fPIE -fPIC -fvisibility=hidden -pie -rdynamic -lpthread -lrt -lm

SVT-VP9

Tuning: Visual Quality Optimized - Input: Bosphorus 1080p

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-VP9 0.1Tuning: Visual Quality Optimized - Input: Bosphorus 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-641326395265SE +/- 0.59, N = 13SE +/- 0.60, N = 13SE +/- 0.59, N = 13SE +/- 0.59, N = 13SE +/- 0.75, N = 13SE +/- 0.58, N = 1354.5454.6954.9254.5257.7554.591. (CC) gcc options: -O3 -fcommon -fPIE -fPIC -fvisibility=hidden -pie -rdynamic -lpthread -lrt -lm

x264

H.264 Video Encoding

OpenBenchmarking.orgFrames Per Second, More Is Betterx264 2019-12-17H.264 Video Encodinghaswellicelake-clientsandybridgeskylaketigerlakex86-64816243240SE +/- 0.45, N = 4SE +/- 0.44, N = 4SE +/- 0.42, N = 4SE +/- 0.43, N = 4SE +/- 0.46, N = 5SE +/- 0.46, N = 432.9533.1533.0033.1134.6833.00-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -ldl -lavformat -lavcodec -lavutil -lswscale -m64 -lm -lpthread -O3 -ffast-math -std=gnu99 -fPIC -fomit-frame-pointer -fno-tree-vectorize

dav1d

Video Input: Chimera 1080p

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Chimera 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-6470140210280350SE +/- 2.38, N = 13SE +/- 2.17, N = 14SE +/- 2.28, N = 13SE +/- 2.13, N = 14SE +/- 2.37, N = 14SE +/- 2.16, N = 14297.97295.30296.44297.51310.73298.17-march=haswell - MIN: 183.29 / MAX: 679.57MIN: 182.34 / MAX: 672.9-march=sandybridge - MIN: 183.11 / MAX: 665.85-march=skylake - MIN: 182.88 / MAX: 673.17-march=tigerlake - MIN: 190.66 / MAX: 684.26-march=x86-64 - MIN: 183.36 / MAX: 680.581. (CC) gcc options: -O3 -pthread

dav1d

Video Input: Summer Nature 4K

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Summer Nature 4Khaswellicelake-clientsandybridgeskylaketigerlakex86-641632486480SE +/- 0.77, N = 7SE +/- 0.73, N = 7SE +/- 0.74, N = 7SE +/- 0.84, N = 6SE +/- 0.81, N = 7SE +/- 0.84, N = 669.2068.9369.2269.6572.5969.06-march=haswell - MIN: 58.48 / MAX: 122.3MIN: 58.33 / MAX: 121.84-march=sandybridge - MIN: 58.59 / MAX: 121.68-march=skylake - MIN: 58.84 / MAX: 122.74-march=tigerlake - MIN: 61.04 / MAX: 124.62-march=x86-64 - MIN: 58.39 / MAX: 121.771. (CC) gcc options: -O3 -pthread

dav1d

Video Input: Summer Nature 1080p

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Summer Nature 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-6470140210280350SE +/- 2.64, N = 14SE +/- 2.74, N = 13SE +/- 2.61, N = 10SE +/- 2.82, N = 13SE +/- 2.76, N = 13SE +/- 2.20, N = 15293.99291.77290.75295.17307.44292.21-march=haswell - MIN: 231.4 / MAX: 403.75MIN: 229.87 / MAX: 397.85-march=sandybridge - MIN: 223.07 / MAX: 402.56-march=skylake - MIN: 232.72 / MAX: 403-march=tigerlake - MIN: 243.06 / MAX: 407.23-march=x86-64 - MIN: 230.01 / MAX: 398.681. (CC) gcc options: -O3 -pthread

dav1d

Video Input: Chimera 1080p 10-bit

OpenBenchmarking.orgFPS, More Is Betterdav1d 0.7.0Video Input: Chimera 1080p 10-bithaswellicelake-clientsandybridgeskylaketigerlakex86-6420406080100SE +/- 1.14, N = 4SE +/- 1.18, N = 4SE +/- 1.30, N = 3SE +/- 1.17, N = 4SE +/- 1.18, N = 4SE +/- 0.91, N = 383.9983.6076.7283.8387.1963.30-march=haswell - MIN: 52.78 / MAX: 272.23MIN: 52.08 / MAX: 270.32-march=sandybridge - MIN: 48.59 / MAX: 245.42-march=skylake - MIN: 52.85 / MAX: 269.19-march=tigerlake - MIN: 54.06 / MAX: 272.51-march=x86-64 - MIN: 40.58 / MAX: 204.761. (CC) gcc options: -O3 -pthread

SVT-AV1

Encoder Mode: Enc Mode 4 - Input: 1080p

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-AV1 0.8Encoder Mode: Enc Mode 4 - Input: 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-640.30290.60580.90871.21161.5145SE +/- 0.008, N = 3SE +/- 0.006, N = 3SE +/- 0.007, N = 3SE +/- 0.008, N = 3SE +/- 0.009, N = 3SE +/- 0.009, N = 31.2891.2881.2911.2911.3461.2861. (CXX) g++ options: -O3 -fcommon -fPIE -fPIC -pie

SVT-AV1

Encoder Mode: Enc Mode 8 - Input: 1080p

OpenBenchmarking.orgFrames Per Second, More Is BetterSVT-AV1 0.8Encoder Mode: Enc Mode 8 - Input: 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-643691215SE +/- 0.17, N = 3SE +/- 0.16, N = 3SE +/- 0.18, N = 3SE +/- 0.17, N = 3SE +/- 0.17, N = 3SE +/- 0.19, N = 311.4211.4311.4211.4311.8811.381. (CXX) g++ options: -O3 -fcommon -fPIE -fPIC -pie

x265

Video Input: Bosphorus 4K

OpenBenchmarking.orgFrames Per Second, More Is Betterx265 3.4Video Input: Bosphorus 4Khaswellicelake-clientsandybridgeskylaketigerlakex86-641.21052.4213.63154.8426.0525SE +/- 0.02, N = 3SE +/- 0.03, N = 3SE +/- 0.03, N = 3SE +/- 0.01, N = 3SE +/- 0.03, N = 3SE +/- 0.03, N = 35.245.215.275.275.385.30-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lpthread -lrt -ldl -lnuma

x265

Video Input: Bosphorus 1080p

OpenBenchmarking.orgFrames Per Second, More Is Betterx265 3.4Video Input: Bosphorus 1080phaswellicelake-clientsandybridgeskylaketigerlakex86-64612182430SE +/- 0.38, N = 3SE +/- 0.39, N = 3SE +/- 0.41, N = 3SE +/- 0.35, N = 4SE +/- 0.30, N = 5SE +/- 0.41, N = 324.6424.5024.6724.8125.2524.87-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CXX) g++ options: -O3 -rdynamic -lpthread -lrt -ldl -lnuma

C-Ray

Total Time - 4K, 16 Rays Per Pixel

OpenBenchmarking.orgSeconds, Fewer Is BetterC-Ray 1.1Total Time - 4K, 16 Rays Per Pixelhaswellicelake-clientsandybridgeskylaketigerlakex86-6450100150200250SE +/- 0.53, N = 3SE +/- 0.61, N = 3SE +/- 0.42, N = 3SE +/- 0.28, N = 3SE +/- 0.58, N = 3SE +/- 0.67, N = 3159.43156.66220.65159.13153.13219.71-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -lm -lpthread -O3

OpenSSL

RSA 4096-bit Performance

OpenBenchmarking.orgSigns Per Second, More Is BetterOpenSSL 1.1.1RSA 4096-bit Performancehaswellicelake-clientsandybridgeskylaketigerlakex86-642004006008001000SE +/- 9.22, N = 12SE +/- 8.55, N = 14SE +/- 8.76, N = 13SE +/- 7.99, N = 14SE +/- 9.56, N = 13SE +/- 7.34, N = 14898.0892.9899.4892.4927.5892.3-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -pthread -m64 -O3 -lssl -lcrypto -ldl

SQLite Speedtest

Timed Time - Size 1,000

OpenBenchmarking.orgSeconds, Fewer Is BetterSQLite Speedtest 3.30Timed Time - Size 1,000haswellicelake-clientsandybridgeskylaketigerlakex86-641224364860SE +/- 0.30, N = 3SE +/- 0.39, N = 3SE +/- 0.54, N = 3SE +/- 0.49, N = 3SE +/- 0.42, N = 3SE +/- 0.53, N = 353.0252.4152.2352.3850.5652.33-march=haswell-march=sandybridge-march=skylake-march=tigerlake-march=x86-641. (CC) gcc options: -O3 -ldl -lz -lpthread


Phoronix Test Suite v10.8.5